PDB entry 1otc

View 1otc on RCSB PDB site
Description: the o. nova telomere end binding protein complexed with single strand DNA
Class: protein/DNA
Keywords: single strand DNA binding protein, protein DNA interactions, protein protein interactions, oligonucleotide and oligosaccharide binding fold, ob fold, telomeres
Deposited on 1998-11-25, released 1999-04-12
The last revision prior to the SCOP 1.75 freeze date was dated 1999-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (telomere-binding protein alpha subunit)
    Species: Oxytricha nova
    Gene: MAC-56A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1otca1, d1otca2, d1otca3
  • Chain 'B':
    Compound: protein (telomere-binding protein beta subunit)
    Species: Oxytricha nova
    Gene: MAC-41A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1otcb_
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*gp*gp*tp*tp*tp*tp*gp*gp*gp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1otcA (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otcA (A:)
    eyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdasd
    yatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsv
    tqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnk
    aqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsa
    tydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvlt
    evdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktkk
    ssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhknad
    arkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1otcB (B:)
    mskgasapqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffva
    pyftkeavnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhs
    fkpnlqerlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaag
    kkgkvdagivkasaskgdefsdfsfkegntatlkiadifvqekgkdalnkaadhtdgakv
    kggakgkgkaaakaakgkkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otcB (B:)
    qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
    efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
    nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
    vkasaskgdefsdfsfkegntatlkiadifvqe
    

  • Chain 'D':
    No sequence available.