PDB entry 1otc

View 1otc on RCSB PDB site
Description: the o. nova telomere end binding protein complexed with single strand dna
Deposited on 1998-11-25, released 1999-04-12
The last revision prior to the SCOP 1.67 freeze date was dated 1999-04-12, with a file datestamp of 1999-04-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1otcA (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsvevaslkknvslnavvltevdkkhaalpstslqdlfhhadsd
    kelqaqdtfrtqfyvtkiepsdvkewvkgydrktkkssslkgasgkgdnifqvqflvkda
    stqlnnntyrvllytqdglganffnvkadnlhknadarkkledsaelltkfnsyvdavve
    rrngfylikdtkliy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otcA (A:)
    eyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdasd
    yatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsv
    tqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnk
    aqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsa
    tydetstqkkvlilshysniitfiqssklakelrakiqddhsvevaslkknvslnavvlt
    evdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvkgydrktkk
    ssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvkadnlhknad
    arkkledsaelltkfnsyvdavverrngfylikdtkliy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1otcB (B:)
    mskgasapqqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffva
    pyftkeavnefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhs
    fkpnlqerlnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaag
    kkgkvdagivkasaskgdefsdfsfkegntatlkiadifvqekgkdalnkaadhtdgakv
    kggakgkgkaaakaakgkkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1otcB (B:)
    qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
    efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
    nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
    vkasaskgdefsdfsfkegntatlkiadifvqe