PDB entry 1ot8

View 1ot8 on RCSB PDB site
Description: Structure of the Ankyrin Domain of the Drosophila Notch Receptor
Class: signaling protein
Keywords: Ankyrin Repeat, membrane protein, SIGNALING PROTEIN
Deposited on 2003-03-21, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus Notch protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: N OR EG:140G11.1 OR EG:163A10.2 OR CG3936
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07207
      • engineered (78)
      • engineered (199)
    Domains in SCOPe 2.07: d1ot8a_
  • Chain 'B':
    Compound: Neurogenic locus Notch protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: N OR EG:140G11.1 OR EG:163A10.2 OR CG3936
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07207 (Start-238)
      • engineered (78)
      • engineered (199)
    Domains in SCOPe 2.07: d1ot8b_
  • Chain 'C':
    Compound: Neurogenic locus Notch protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: N OR EG:140G11.1 OR EG:163A10.2 OR CG3936
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07207
      • engineered (78)
      • engineered (199)
    Domains in SCOPe 2.07: d1ot8c_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ot8A (A:)
    mgltplmiaavrgggldtgediennedstaqvisdllaqgaelnatmdktgetslhlaar
    faradaakrlldagadansqdntgrtplhaavaadamgvfqillrnratnlnarmhdgtt
    plilaarlaiegmvedlitadadinaadnsgktalhwaaavnnteavnillmhhanrdaq
    ddkdetplflaaregsyeaskalldnfanreitdhmdrlprdvaserlhhdivrlldeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ot8A (A:)
    taqvisdllaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtpl
    haavaadamgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaad
    nsgktalhwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfa
    nreitdhmdrlprdvaserlhhdivrlld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ot8B (B:)
    mgltplmiaavrgggldtgediennedstaqvisdllaqgaelnatmdktgetslhlaar
    faradaakrlldagadansqdntgrtplhaavaadamgvfqillrnratnlnarmhdgtt
    plilaarlaiegmvedlitadadinaadnsgktalhwaaavnnteavnillmhhanrdaq
    ddkdetplflaaregsyeaskalldnfanreitdhmdrlprdvaserlhhdivrlldeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ot8B (B:)
    llaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtplhaavaad
    amgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaadnsgktal
    hwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfanreitdh
    mdrlprdvaserlhhdivrlldeh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ot8C (C:)
    mgltplmiaavrgggldtgediennedstaqvisdllaqgaelnatmdktgetslhlaar
    faradaakrlldagadansqdntgrtplhaavaadamgvfqillrnratnlnarmhdgtt
    plilaarlaiegmvedlitadadinaadnsgktalhwaaavnnteavnillmhhanrdaq
    ddkdetplflaaregsyeaskalldnfanreitdhmdrlprdvaserlhhdivrlldeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ot8C (C:)
    mdktgetslhlaarfaradaakrlldagadansqdntgrtplhaavaadamgvfqillrn
    ratnlnarmhdgttplilaarlaiegmvedlitadadinaadnsgktalhwaaavnntea
    vnillmhhanrdaqddkdetplflaaregsyeaskalldnfanreitdhmdrlprdvase
    rlhhdivrllde