PDB entry 1ot7
View 1ot7 on RCSB PDB site
Description: Structural Basis for 3-deoxy-CDCA Binding and Activation of FXR
Class: hormone/growth factor receptor
Keywords: bile acid, nuclear receptor, coactivator, ligand binding domain, fxr, hormone/growth factor receptor complex
Deposited on
2003-03-21, released
2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.19
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bile acid receptor
Species: Rattus norvegicus [TaxId:10116]
Gene: NR1H4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ot7a_ - Chain 'B':
Compound: Bile acid receptor
Species: Rattus norvegicus [TaxId:10116]
Gene: NR1H4
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1ot7b_ - Chain 'C':
Compound: dodecamer peptide fragment of RPGR-interacting protein 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: dodecamer peptide fragment of RPGR-interacting protein 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: dodecamer peptide fragment of RPGR-interacting protein 1
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: IU5, CHC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1ot7A (A:)
teltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1ot7B (B:)
teltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.