PDB entry 1ot7

View 1ot7 on RCSB PDB site
Description: Structural Basis for 3-deoxy-CDCA Binding and Activation of FXR
Class: hormone/growth factor receptor
Keywords: bile acid, nuclear receptor, coactivator, ligand binding domain, fxr, hormone/growth factor receptor complex
Deposited on 2003-03-21, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR1H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ot7a_
  • Chain 'B':
    Compound: Bile acid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR1H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ot7b_
  • Chain 'C':
    Compound: dodecamer peptide fragment of RPGR-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OT7 (0-11)
  • Chain 'D':
    Compound: dodecamer peptide fragment of RPGR-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OT7 (0-11)
  • Chain 'E':
    Compound: dodecamer peptide fragment of RPGR-interacting protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OT7 (0-11)
  • Heterogens: IU5, CHC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot7A (A:)
    teltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot7B (B:)
    teltvdqqtlldyimdsyskqrmpqeitnkilkeefsaeenfliltematshvqilveft
    krlpgfqtldhedqiallkgsaveamflrsaeifnkklpaghadlleerirksgisdeyi
    tpmfsfyksvgelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckiy
    qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.