PDB entry 1ot6

View 1ot6 on RCSB PDB site
Description: cryotrapped crystal structure of the e46q mutant of photoactive yellow protein under continuous illumination at 110k
Class: signaling protein
Keywords: PYP, cryotrapping
Deposited on 2003-03-21, released 2004-05-11
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-15, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.144
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: Ectothiorhodospira halophila
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • engineered (45)
    Domains in SCOP 1.73: d1ot6a_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot6A (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv