PDB entry 1ot5

View 1ot5 on RCSB PDB site
Description: The 2.4 Angstrom Crystal Sructure of Kex2 in complex with a peptidyl-boronic acid inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: subtilisin fold, peptidyl-boronic acid, serine protease, P-domain, hydrolase, hydrolase-hydrolase inhibitor complex
Deposited on 2003-03-21, released 2003-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2 OR QDS1 OR YNL238W OR N1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ot5a1, d1ot5a2
  • Chain 'B':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2 OR QDS1 OR YNL238W OR N1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ot5b1, d1ot5b2
  • Chain 'C':
    Compound: Ac-Ala-Lys-boroArg N-acetylated boronic acid peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OT5 (Start-2)
  • Chain 'D':
    Compound: Ac-Ala-Lys-boroArg N-acetylated boronic acid peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OT5 (Start-2)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot5A (A:)
    pvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldyen
    edlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakisg
    irilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegrd
    skgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtyss
    gsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgle
    knadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstnst
    eetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvrpr
    dvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidssk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot5B (B:)
    pvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldyen
    edlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynakisg
    irilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvtegrd
    skgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavtyss
    gsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavgle
    knadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstnst
    eetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvrpr
    dvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidssk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.