PDB entry 1ot1

View 1ot1 on RCSB PDB site
Description: Bacillus circulans strain 251 Cyclodextrin glycosyl transferase mutant D135A
Class: transferase
Keywords: glycosyl transferase, cyclodextrin
Deposited on 2003-03-21, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.152
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrin glucanotransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43379 (0-685)
      • engineered (134)
      • see remark 999 (399)
    Domains in SCOPe 2.07: d1ot1a1, d1ot1a2, d1ot1a3, d1ot1a4
  • Heterogens: MAL, CA, EPE, MPD, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ot1A (A:)
    apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
    indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
    liaaahaknikviiafapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
    tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
    sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
    yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
    gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiaygstqerwinndvli
    yerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllngntlsvgsggaasnf
    tlaaggtavwqytaatatptighvgpmmakpgvtitidgrgfgsskgtvyfgttavsgad
    itswedtqikvkipavaggnynikvanaagtasnvydnfevlsgdqvsvrfvvnnattal
    gqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvsvpagktiefkflkkqgstv
    tweggsnhtftapssgtatinvnwqp