PDB entry 1osy

View 1osy on RCSB PDB site
Description: Crystal structure of FIP-Fve fungal immunomodulatory protein
Deposited on 2003-03-20, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1osya_
  • Chain 'B':
    Domains in SCOP 1.67: d1osyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1osyA (A:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1osyB (B:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osyB (B:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewk