PDB entry 1osy

View 1osy on RCSB PDB site
Description: Crystal structure of FIP-Fve fungal immunomodulatory protein
Class: sugar binding protein, immune system
Keywords: fungal protein, immunomodulatory, fibronectin fold, hemagglutination, lectin, SUGAR BINDING PROTEIN, IMMUNE SYSTEM
Deposited on 2003-03-20, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunomodulatory protein fip-fve
    Species: Flammulina velutipes [TaxId:38945]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1osya_
  • Chain 'B':
    Compound: immunomodulatory protein fip-fve
    Species: Flammulina velutipes [TaxId:38945]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1osyb_
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1osyA (A:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1osyB (B:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewkkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osyB (B:)
    satsltfqlaylvkkidfdytpnwgrgtpssyidnltfpkvltdkkysyrvvvngsdlgv
    esnfavtpsggqtinflqynkgygvadtktiqvfvvipdtgnseeyiiaewk