PDB entry 1oss

View 1oss on RCSB PDB site
Description: t190p streptomyces griseus trypsin in complex with benzamidine
Class: hydrolase
Keywords: trypsin, serine protease, mutant, hydrolase
Deposited on 2003-03-20, released 2003-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.167
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sprT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00775 (0-215)
      • engineered (166)
    Domains in SCOPe 2.07: d1ossa_
  • Heterogens: SO4, CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ossA (A:)
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
savkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdpcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl