PDB entry 1osp

View 1osp on RCSB PDB site
Description:
Deposited on 1996-11-23, released 1997-04-21
The last revision prior to the SCOP 1.65 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.229
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1osph1, d1osph2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ospl1, d1ospl2
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1ospo_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ospH (H:)
    evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
    pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa
    akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
    lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ospL (L:)
    diqmsqssssfsvslgdrvtitckasediysrlawyqqkpgnaprllisgatsletwvps
    rfsgsdsgkdytlsitslqtedvatyfcqqywsppptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ospO (O:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ospO (O:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk