PDB entry 1osp

View 1osp on RCSB PDB site
Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
Class: complex (immunoglobulin/lipoprotein)
Keywords: COMPLEX (IMMUNOGLOBULIN-LIPOPROTEIN), OUTER SURFACE PROTEIN A COMPLEXED WITH FAB184.1, BORRELIA BURGDORFERI STRAIN B31, COMPLEX (IMMUNOGLOBULIN-LIPOPROTEIN) complex
Deposited on 1996-11-23, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.229
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab 184.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1osph1, d1osph2
  • Chain 'L':
    Compound: fab 184.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OSP (0-213)
    Domains in SCOPe 2.07: d1ospl1, d1ospl2
  • Chain 'O':
    Compound: Outer surface protein A
    Species: Borrelia burgdorferi [TaxId:224326]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14013 (Start-256)
      • variant (22)
      • engineered (67)
      • variant (132)
      • variant (147)
    Domains in SCOPe 2.07: d1ospo_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ospH (H:)
    evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
    pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa
    akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
    lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ospL (L:)
    diqmsqssssfsvslgdrvtitckasediysrlawyqqkpgnaprllisgatsletwvps
    rfsgsdsgkdytlsitslqtedvatyfcqqywsppptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ospO (O:)
    akqnvssldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvl
    egvkadkckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevseki
    itradgtrleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksge
    vsvelndtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtkle
    gsaveitkldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ospO (O:)
    sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
    kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
    dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
    tkldeiknalk