PDB entry 1osl

View 1osl on RCSB PDB site
Description: Solution structure of a dimeric lactose DNA-binding domain complexed to a nonspecific DNA sequence
Class: transcription/DNA
Keywords: Protein-DNA complex, Lac repressor, nonspecific interaction, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-03-20, released 2004-05-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lactose operon repressor
  Species: Escherichia coli [TaxId:562]
  Gene: lacI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03023 (0-61)
    • engineered (51)
  Domains in SCOPe 2.05: d1osla_
• Chain 'B':
  Compound: lactose operon repressor
  Species: Escherichia coli [TaxId:562]
  Gene: lacI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03023 (0-61)
    • engineered (51)
  Domains in SCOPe 2.05: d1oslb_
• Chain 'C':
  Compound: 5'-d(*cp*gp*ap*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*tp*cp*g)-3'
  
• Chain 'D':
  Compound: 5'-d(*cp*gp*ap*tp*ap*ap*gp*ap*tp*ap*tp*cp*tp*tp*ap*tp*cp*g)-3'
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oslA (A:)
  mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
  sl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oslB (B:)
  mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
  sl
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.