PDB entry 1osc

View 1osc on RCSB PDB site
Description: Crystal structure of rat CUTA1 at 2.15 A resolution
Class: unknown function
Keywords: CUTA, copper resistance, Structural Proteomics in Europe, SPINE, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2003-03-19, released 2003-11-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1osca_
  • Chain 'B':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oscb_
  • Chain 'C':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oscc_
  • Chain 'D':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oscd_
  • Chain 'E':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1osce_
  • Chain 'F':
    Compound: similar to divalent cation tolerant protein CUTA
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CutA, CutA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1oscf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oscA (A:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscA (A:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oscB (B:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscB (B:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtesv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1oscC (C:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscC (C:)
    yvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevlmm
    iktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvtes
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oscD (D:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscD (D:)
    sgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsevl
    mmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvhqvte
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1oscE (E:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscE (E:)
    gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
    lmmiktqsslvpaltefvrsvhpvaevialpveqgnppylhwvhqvtesv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1oscF (F:)
    masgsppsqpspasgsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqits
    iyewkgkieedsevlmmiktqsslvpaltefvrsvhpyevaevialpveqgnppylhwvh
    qvtesv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oscF (F:)
    gsgyvpgsvsaafvtcpnekvakeiaravvekrlaacvnlipqitsiyewkgkieedsev
    lmmiktqsslvpaltefvrsvhpyvaevialpveqgnppylhwvhqvtesv