PDB entry 1osb

View 1osb on RCSB PDB site
Description: Conjugative Relaxase TrwC in complex with OriT Dna. Metal-free structure.
Class: transferase/DNA
Keywords: Bacterial conjugation, Relaxase, DNA replication, TRANSFERASE/DNA COMPLEX
Deposited on 2003-03-19, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trwC protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1osba_
  • Chain 'B':
    Compound: DNA oligonucleotide
  • Chain 'C':
    Compound: trwC protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1osbc_
  • Chain 'D':
    Compound: DNA oligonucleotide
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1osbA (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osbA (A:)
    mlshmvltrqdigraasyyedgadgdasewqgkgaeelglsgevdskrfrellagnigeg
    hrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaq
    arqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeiv
    katrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaar
    gldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1osbC (C:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osbC (C:)
    mlshmvltrqdigraasyyegdasewqgkgaeelglsgevdskrfrellagnigeghrim
    rsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaqarqk
    iqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeivkatr
    ylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaargldp
    nsvsleqkqaakvlsrakktsvdrealraewqatakelgidf
    

  • Chain 'D':
    No sequence available.