PDB entry 1osb

View 1osb on RCSB PDB site
Description: conjugative relaxase trwc in complex with orit dna. metal-free structure.
Deposited on 2003-03-19, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1osba_
  • Chain 'C':
    Domains in SCOP 1.67: d1osbc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1osbA (A:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osbA (A:)
    mlshmvltrqdigraasyyedgadgdasewqgkgaeelglsgevdskrfrellagnigeg
    hrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaq
    arqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeiv
    katrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaar
    gldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1osbC (C:)
    mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
    gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
    aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
    kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
    ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1osbC (C:)
    mlshmvltrqdigraasyyegdasewqgkgaeelglsgevdskrfrellagnigeghrim
    rsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleqaearaqarqk
    iqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwralkndeivkatr
    ylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqiaewyaargldp
    nsvsleqkqaakvlsrakktsvdrealraewqatakelgidf