PDB entry 1osa

View 1osa on RCSB PDB site
Description: crystal structure of recombinant paramecium tetraurelia calmodulin at 1.68 angstroms resolution
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-08-11, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.194
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Paramecium tetraurelia
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07463 (0-147)
  Domains in SCOP 1.75: d1osaa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1osaA (A:)
  aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
  gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
  vdemireadidgdghinyeefvrmmvsk