PDB entry 1os8

View 1os8 on RCSB PDB site
Description: recombinant streptomyces griseus trypsin
Class: hydrolase
Keywords: trypsin, serine protease, hydrolase
Deposited on 2003-03-18, released 2003-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.196
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sprT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1os8a_
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os8A (A:)
    vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
    savkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
    ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
    nadewiqvgivswgygcarpgypgvytevstfasaiasaartl