PDB entry 1os2

View 1os2 on RCSB PDB site
Description: Ternary enzyme-product-inhibitor complexes of human MMP12
Class: hydrolase
Keywords: matrix metalloproteinase, hydroxamic acid, mmp12, elastase, complex (elastase/inhibitor), metallo elastase, hydrolase
Deposited on 2003-03-18, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2a1, d1os2a2
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2b1, d1os2b2
  • Chain 'C':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2c1, d1os2c2
  • Chain 'D':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2d1, d1os2d2
  • Chain 'E':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2e1, d1os2e2
  • Chain 'F':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12 OR HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (2-164)
      • cloning artifact (0-1)
      • engineered (67)
    Domains in SCOPe 2.06: d1os2f1, d1os2f2
  • Heterogens: ZN, CA, ACT, AZI, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2A (A:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2B (B:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2C (C:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2D (D:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2E (E:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2F (F:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken