PDB entry 1os2

View 1os2 on RCSB PDB site
Description: Ternary enzyme-product-inhibitor complexes of human MMP12
Deposited on 2003-03-18, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.215
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1os2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1os2b_
  • Chain 'C':
    Domains in SCOP 1.67: d1os2c_
  • Chain 'D':
    Domains in SCOP 1.67: d1os2d_
  • Chain 'E':
    Domains in SCOP 1.67: d1os2e_
  • Chain 'F':
    Domains in SCOP 1.67: d1os2f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2A (A:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2B (B:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2C (C:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2D (D:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2E (E:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1os2F (F:)
    mmgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvf
    argahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighs
    lglghssdpkavmfptykyvdintfrlsaddirgiqslygdpken