PDB entry 1ory

View 1ory on RCSB PDB site
Description: flagellar export chaperone in complex with its cognate binding partner
Class: chaperone
Keywords: flagellar chaperone, cytosolic export chaperone, flagellin, FliS, FliC, CHAPERONE
Deposited on 2003-03-17, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flagellar protein FliS
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: FliS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67806 (Start-123)
      • engineered (11)
    Domains in SCOPe 2.08: d1orya_
  • Chain 'B':
    Compound: Flagellin
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: FLAA OR FLIC OR AQ_1998
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oryA (A:)
mrniaeayfqnqvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvy
diisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweev
kkkvhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1oryA (A:)
eayfqnqvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisa
lksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevkkkv

  • Chain 'B':
    No sequence available.