PDB entry 1orv

View 1orv on RCSB PDB site
Description: Crystal Structure of Porcine Dipeptidyl Peptidase IV (CD26)
Class: hydrolase
Keywords: serine protease, mechanism, oxyanion hole, substrate channeling, drug design, diabetes mellitus
Deposited on 2003-03-16, released 2003-05-06
The last revision prior to the SCOP 1.73 freeze date was dated 2003-05-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase IV
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • GB AAO43404 (0-727)
    Domains in SCOP 1.73: d1orva1, d1orva2
  • Chain 'B':
    Compound: dipeptidyl peptidase IV
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • GB AAO43404 (0-727)
    Domains in SCOP 1.73: d1orvb1, d1orvb2
  • Chain 'C':
    Compound: dipeptidyl peptidase IV
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • GB AAO43404 (0-727)
    Domains in SCOP 1.73: d1orvc1, d1orvc2
  • Chain 'D':
    Compound: dipeptidyl peptidase IV
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • GB AAO43404 (0-727)
    Domains in SCOP 1.73: d1orvd1, d1orvd2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orvA (A:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orvB (B:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orvC (C:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orvD (D:)
    srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
    gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
    pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
    ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
    nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
    ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
    kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
    asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvqmpskkldvin
    lhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatylasteniivasf
    dgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwgwsyggyvtsm
    vlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstvmsraenfkqv
    eyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmahqhiythmshf
    lkqcfslp