PDB entry 1oru

View 1oru on RCSB PDB site
Description: Crystal Structure of APC1665, YUAD protein from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: Structural Genomics, YUAD protein, Cytosolic Hypothetical Protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-03-15, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yuaD protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32079
      • modified residue (3)
      • modified residue (7)
      • modified residue (27)
      • modified residue (55)
      • modified residue (83)
      • modified residue (102)
    Domains in SCOPe 2.07: d1orua_
  • Chain 'B':
    Compound: yuaD protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32079
      • modified residue (3)
      • modified residue (7)
      • modified residue (27)
      • modified residue (55)
      • modified residue (83)
      • modified residue (102)
    Domains in SCOPe 2.07: d1orub_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oruA (A:)
    snamwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrg
    teifnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsg
    aallcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeie
    vhsyqrkvkrkaerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oruA (A:)
    mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgtei
    fnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaal
    lcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeievhs
    yq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oruB (B:)
    snamwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrg
    teifnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsg
    aallcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeie
    vhsyqrkvkrkaerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oruB (B:)
    mwkrmtakaeglyiadtksfvtkqmdkldfdyggipgdlhfgltkkagarepmfsrgtei
    fnrrqisivsieecneialkmgvprilpewlganvavsgmpdltslkegsriifpsgaal
    lcegendpciqpgeviqsyypdqpklasafvrhalgirgivciverpgavytgdeievhs
    yq