PDB entry 1ors

View 1ors on RCSB PDB site
Description: X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab
Deposited on 2003-03-14, released 2003-05-06
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsA (A:)
    qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsB (B:)
    dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
    npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsC (C:)
    dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
    sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
    aiadaadklvpr