PDB entry 1ors

View 1ors on RCSB PDB site
Description:
Deposited on 2003-03-14, released 2003-05-06
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1orsa1, d1orsa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1orsb1, d1orsb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1orsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsA (A:)
    qivltqspaimsaslgdrvtmtctasssvsssylhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqfhrsltfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsB (B:)
    dvqlqesgpglvkpsqslsltctvtgysitnnyawnwirqfpgnklewmgyinysgttsy
    npslksrisitrdtsknqfflqlnsvttedtatyfcvrgydyfamdywgqgtsvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orsC (C:)
    dvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdlilviilwadyayrayk
    sgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskfls
    aiadaadklvpr