PDB entry 1ork

View 1ork on RCSB PDB site
Description: tet repressor, class d in complex with 9-(n,n-dimethylglycylamido)-6-demethyl-6-deoxy-tetracycline
Deposited on 1998-05-21, released 1999-06-15
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ork_ (-)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ork_ (-)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaanlppllrealqimdsddgeqaflhgle
    slirgfevqltallqiv