PDB entry 1orj

View 1orj on RCSB PDB site
Description: flagellar export chaperone
Class: chaperone
Keywords: flagellin, flagellar export, chaperone, flagellum, four helix bundle
Deposited on 2003-03-13, released 2003-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flagellar protein FliS
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: FliS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67806
      • expression tag (124-126)
    Domains in SCOPe 2.06: d1orja1, d1orja2
  • Chain 'B':
    Compound: flagellar protein FliS
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: FliS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1orjb_
  • Chain 'C':
    Compound: flagellar protein FliS
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: FliS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1orjc_
  • Chain 'D':
    Compound: flagellar protein FliS
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: FliS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67806 (Start-123)
      • expression tag (124-125)
    Domains in SCOPe 2.06: d1orjd1, d1orjd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1orjA (A:)
    mrniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvy
    diisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweev
    kkkvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orjA (A:)
    rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
    iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
    kkvhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1orjB (B:)
    mrniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvy
    diisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweev
    kkkvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orjB (B:)
    pleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisalksfldhekgke
    iaknldtiytiilntlvkvdktkeelqkileilkdlreaweevkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1orjC (C:)
    mrniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvy
    diisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweev
    kkkvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orjC (C:)
    pleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisalksfldhekgke
    iaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1orjD (D:)
    mrniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvy
    diisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweev
    kkkvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orjD (D:)
    rniaeayfqnmvetatpleqiillydkaiecleraieiydqvnelekrkefvenidrvyd
    iisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreaweevk
    kkvhh