PDB entry 1ori

View 1ori on RCSB PDB site
Description: Structure of the predominant protein arginine methyltransferase PRMT1
Class: transferase
Keywords: protein arginine methylation AdoMet-dependent methylation, TRANSFERASE
Deposited on 2003-03-13, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine N-methyltransferase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HRMT1L2 OR PRMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oria_
  • Heterogens: SAH, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oriA (A:)
    mevscgqaessekpnaedmtskdyyfdsyahfgiheemlkdevrtltyrnsmfhnrhlfk
    dkvvldvgsgtgilcmfaakagarkvigiecssisdyavkivkankldhvvtiikgkvee
    velpvekvdiiisewmgyclfyesmlntvlhardkwlapdglifpdratlyvtaiedrqy
    kdykihwwenvygfdmscikdvaikeplvdvvdpkqlvtnaclikevdiytvkvedltft
    spfclqvkrndyvhalvayfnieftrchkrtgfstspespythwkqtvfymedyltvktg
    eeifgtigmrpnaknnrdldftidldfkgqlcelscstdyrmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oriA (A:)
    syahfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagarkvi
    giecssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyesmln
    tvlhardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaikep
    lvdvvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieftrc
    hkrtgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidldf
    kgqlcelscstdyrmr