PDB entry 1ori

View 1ori on RCSB PDB site
Description: Structure of the predominant protein arginine methyltransferase PRMT1
Deposited on 2003-03-13, released 2003-05-27
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1oria_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oriA (A:)
    mevscgqaessekpnaedmtskdyyfdsyahfgiheemlkdevrtltyrnsmfhnrhlfk
    dkvvldvgsgtgilcmfaakagarkvigiecssisdyavkivkankldhvvtiikgkvee
    velpvekvdiiisewmgyclfyesmlntvlhardkwlapdglifpdratlyvtaiedrqy
    kdykihwwenvygfdmscikdvaikeplvdvvdpkqlvtnaclikevdiytvkvedltft
    spfclqvkrndyvhalvayfnieftrchkrtgfstspespythwkqtvfymedyltvktg
    eeifgtigmrpnaknnrdldftidldfkgqlcelscstdyrmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oriA (A:)
    syahfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagarkvi
    giecssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyesmln
    tvlhardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaikep
    lvdvvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieftrc
    hkrtgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidldf
    kgqlcelscstdyrmr