PDB entry 1orh

View 1orh on RCSB PDB site
Description: Structure of the Predominant Protein Arginine Methyltransferase PRMT1
Class: transferase
Keywords: protein arginine methylation AdoMet-dependent methylation, TRANSFERASE
Deposited on 2003-03-13, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine N-methyltransferase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HRMT1L2 OR PRMT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63009 (Start-352)
      • engineered (152)
    Domains in SCOPe 2.08: d1orha_
  • Chain 'B':
    Compound: substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ORH (0-9)
  • Heterogens: SAH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1orhA (A:)
    maaaeaancimevscgqaessekpnaedmtskdyyfdsyahfgiheemlkdevrtltyrn
    smfhnrhlfkdkvvldvgsgtgilcmfaakagarkvigiecssisdyavkivkankldhv
    vtiikgkveevelpvekvdiiisewmgyclfyqsmlntvlhardkwlapdglifpdratl
    yvtaiedrqykdykihwwenvygfdmscikdvaikeplvdvvdpkqlvtnaclikevdiy
    tvkvedltftspfclqvkrndyvhalvayfnieftrchkrtgfstspespythwkqtvfy
    medyltvktgeeifgtigmrpnaknnrdldftidldfkgqlcelscstdyrmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orhA (A:)
    fdsyahfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagark
    vigiecssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyqsm
    lntvlhardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaik
    eplvdvvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieft
    rchkrtgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidl
    dfkgqlcelscstdyrmr
    

  • Chain 'B':
    No sequence available.