PDB entry 1org
View 1org on RCSB PDB site
Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
Class: transport protein
Keywords: Pheromone binding Protein, APO-FORM, 6 ALPHA HELIX, Transport protein
Deposited on
2003-03-13, released
2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: pheromone binding protein
Species: Leucophaea maderae [TaxId:6988]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1orga_ - Chain 'B':
Compound: pheromone binding protein
Species: Leucophaea maderae [TaxId:6988]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1orgb_ - Heterogens: GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1orgA (A:)
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1orgB (B:)
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy