PDB entry 1org

View 1org on RCSB PDB site
Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding
Class: transport protein
Keywords: Pheromone binding Protein, APO-FORM, 6 ALPHA HELIX, Transport protein
Deposited on 2003-03-13, released 2003-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1orga_
  • Chain 'B':
    Compound: pheromone binding protein
    Species: Leucophaea maderae [TaxId:6988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1orgb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orgA (A:)
    stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
    iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orgB (B:)
    stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
    iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy