PDB entry 1orf

View 1orf on RCSB PDB site
Description: The Oligomeric Structure of Human Granzyme A Reveals the Molecular Determinants of Substrate Specificity
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2003-03-12, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granzyme A
    Species: Homo sapiens [TaxId:9606]
    Gene: GZMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12544 (0-End)
      • engineered (139)
    Domains in SCOPe 2.07: d1orfa_
  • Heterogens: 0G6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1orfA (A:)
    iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
    eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
    qvagwgrthnsaswsdtlreveitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
    ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikgav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1orfA (A:)
    iiggnevtphsrpymvllsldrkticagaliakdwvltaahcnlnkrsqvilgahsitre
    eptkqimlvkkefpypcydpatregdlkllqltekakinkyvtilhlpkkgddvkpgtmc
    qvagwgrthnsaswsdtlreveitiidrkvcndrnhynfnpvigmnmvcagslrggrdsc
    ngdsgspllcegvfrgvtsfglenkcgdprgpgvyillskkhlnwiimtikg