PDB entry 1ord

View 1ord on RCSB PDB site
Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution
Class: carboxy-lyase
Keywords: carboxy-lyase
Deposited on 1995-02-08, released 1995-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine decarboxylase
    Species: Lactobacillus sp. [TaxId:1593]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1orda1, d1orda2, d1orda3
  • Chain 'B':
    Compound: ornithine decarboxylase
    Species: Lactobacillus sp. [TaxId:1593]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ordb1, d1ordb2, d1ordb3
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ordA (A:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsilppffkslkeyvsr
    gliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaek
    haarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvy
    lqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynah
    evvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagf
    sqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrkl
    whdllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwha
    yegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsil
    flmtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelh
    dfyknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpy
    ppgvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydae
    vaknddrynn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ordB (B:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsilppffkslkeyvsr
    gliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaek
    haarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvy
    lqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynah
    evvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagf
    sqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrkl
    whdllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwha
    yegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsil
    flmtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelh
    dfyknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpy
    ppgvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydae
    vaknddrynn