PDB entry 1orb

View 1orb on RCSB PDB site
Description: active site structural features for chemically modified forms of rhodanese
Deposited on 1995-07-24, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1orb_ (-)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg