PDB entry 1or8

View 1or8 on RCSB PDB site
Description: Structure of the Predominant protein arginine methyltransferase PRMT1
Class: transferase
Keywords: protein arginine methylation, AdoMet-dependent methylation, TRANSFERASE
Deposited on 2003-03-12, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine N-methyltransferase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HRMT1L2 OR PRMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1or8a_
  • Chain 'B':
    Compound: substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OR8 (Start-12)
  • Chain 'C':
    Compound: substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OR8
  • Chain 'D':
    Compound: substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OR8 (Start-18)
  • Chain 'E':
    Compound: substrate peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OR8
  • Heterogens: SAH, UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1or8A (A:)
    scgqaessekpnaedmtskdyyfdsyahfgiheemlkdevrtltyrnsmfhnrhlfkdkv
    vldvgsgtgilcmfaakagarkvigiecssisdyavkivkankldhvvtiikgkveevel
    pvekvdiiisewmgyclfyesmlntvlhardkwlapdglifpdratlyvtaiedrqykdy
    kihwwenvygfdmscikdvaikeplvdvvdpkqlvtnaclikevdiytvkvedltftspf
    clqvkrndyvhalvayfnieftrchkrtgfstspespythwkqtvfymedyltvktgeei
    fgtigmrpnaknnrdldftidldfkgqlcelscstdyrmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or8A (A:)
    hfgiheemlkdevrtltyrnsmfhnrhlfkdkvvldvgsgtgilcmfaakagarkvigie
    cssisdyavkivkankldhvvtiikgkveevelpvekvdiiisewmgyclfyesmlntvl
    hardkwlapdglifpdratlyvtaiedrqykdykihwwenvygfdmscikdvaikeplvd
    vvdpkqlvtnaclikevdiytvkvedltftspfclqvkrndyvhalvayfnieftrchkr
    tgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftidldfkgq
    lcelscstdyrmr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.