PDB entry 1or7

View 1or7 on RCSB PDB site
Description: Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA
Class: transcription
Keywords: regulation, DNA-BINDING, TRANSMEMBRANE, TRANSCRIPTION
Deposited on 2003-03-12, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase sigma-E factor
    Species: Escherichia coli [TaxId:562]
    Gene: RPOE OR SIGE OR B2573 OR C3097 OR Z3855 OR ECS3439 OR SF2635
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGB6 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1or7a1, d1or7a2, d1or7a3
  • Chain 'B':
    Compound: RNA polymerase sigma-E factor
    Species: Escherichia coli [TaxId:562]
    Gene: RPOE OR SIGE OR B2573 OR C3097 OR Z3855 OR ECS3439 OR SF2635
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGB6 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1or7b1, d1or7b2, d1or7b3
  • Chain 'C':
    Compound: Sigma-E factor negative regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: RSEA OR MCLA OR B2572 OR C3096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1or7c_
  • Chain 'F':
    Compound: Sigma-E factor negative regulatory protein
    Species: Escherichia coli [TaxId:562]
    Gene: RSEA OR MCLA OR B2572 OR C3096
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1or7f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1or7A (A:)
    gshmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafika
    yraldsfrgdsafytwlyriavntaknylvaqgrrppssdvdaieaenfesggalkeisn
    penlmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifra
    reaidnkvqplirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or7A (A:)
    shmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafikay
    raldsfrgdsafytwlyriavntaknylvaqgrrppssdvdaieaenfesgganlmlsee
    lrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrareaidnkvq
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1or7B (B:)
    gshmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafika
    yraldsfrgdsafytwlyriavntaknylvaqgrrppssdvdaieaenfesggalkeisn
    penlmlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifra
    reaidnkvqplirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or7B (B:)
    shmseqltdqvlvervqkgdqkafnllvvryqhkvaslvsryvpsgdvpdvvqeafikay
    raldsfrgdsafytwlyriavntaknylvaqgrnlmlseelrqivfrtieslpedlrmai
    tlreldglsyeeiaaimdcpvgtvrsrifrareaidnkvqplir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1or7C (C:)
    mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
    aaieeepvrqpatlipeaqpaphqwqkmpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or7C (C:)
    mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
    aaieee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1or7F (F:)
    mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
    aaieeepvrqpatlipeaqpaphqwqkmpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or7F (F:)
    mqkeqlsalmdgetldsellnelahnpemqktwesyhlirdsmrgdtpevlhfdissrvm
    aaie