PDB entry 1or6

View 1or6 on RCSB PDB site
Description: Crystal Structure of HemAT sensor domain from B.subtilis in the unliganded form
Deposited on 2003-03-11, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.208
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1or6a_
  • Chain 'B':
    Domains in SCOP 1.67: d1or6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1or6A (A:)
    mlfkkdrkqetayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqe
    nivnivdafyknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnria
    sihlrigllpkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or6A (A:)
    tayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafy
    knldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllp
    kwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1or6B (B:)
    mlfkkdrkqetayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqe
    nivnivdafyknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnria
    sihlrigllpkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or6B (B:)
    nriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafyknldhesslmdi
    indhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllpkwymgafqelll
    smidiyeasitnqqellkaikattkilnleqqlvle