PDB entry 1or4

View 1or4 on RCSB PDB site
Description: Crystal Structure of HemAT sensor domain from B.subtilis in the cyano-liganded form
Class: signaling protein
Keywords: Globin fold, SIGNALING PROTEIN
Deposited on 2003-03-11, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme-based aerotactic transducer hemAT
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhfV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1or4a_
  • Chain 'B':
    Compound: Heme-based aerotactic transducer hemAT
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yhfV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1or4b_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1or4A (A:)
    mlfkkdrkqetayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqe
    nivnivdafyknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnria
    sihlrigllpkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or4A (A:)
    etayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdaf
    yknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigll
    pkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1or4B (B:)
    mlfkkdrkqetayfsdsngqqknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqe
    nivnivdafyknldhesslmdiindhssvdrlkqtlkrhiqemfagviddefiekrnria
    sihlrigllpkwymgafqelllsmidiyeasitnqqellkaikattkilnleqqlvle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or4B (B:)
    qknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafyknldhesslm
    diindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllpkwymgafqel
    llsmidiyeasitnqqellkaikattkilnleqqlvle