PDB entry 1or2

View 1or2 on RCSB PDB site
Description: apolipoprotein e3 (apoe3) truncation mutant 165
Class: lipid binding protein
Keywords: lipid transport, heparin-binding, plasma protein, hdl, vldl, lipid binding protein
Deposited on 1999-03-25, released 2000-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: -3.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02649
      • modified residue (63)
      • modified residue (67)
      • modified residue (107)
      • modified residue (124)
    Domains in SCOPe 2.07: d1or2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1or2A (A:)
    kveqavetepepelrqqtewqsgqrwelalgrfwdylrwvqtlseqvqeellssqvtqel
    ralmdetmkelkaykseleeqltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrg
    evqamlgqsteelrvrlashlrklrkrllrdaddlqkrlavyqag
    

    Sequence, based on observed residues (ATOM records): (download)
    >1or2A (A:)
    gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
    skelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrdad
    dlqkrlavyq