PDB entry 1oqw

View 1oqw on RCSB PDB site
Description: Full-Length PAK Pilin from Pseudomonas aeruginosa
Class: cell adhesion
Keywords: Type IV pilin, fiber-forming protein, adhesion, Pseudomonas aerugionosa, PAK pilin, CELL ADHESION
Deposited on 2003-03-11, released 2003-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqwa_
  • Chain 'B':
    Compound: fimbrial protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oqwA (A:)
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oqwB (B:)
ftlielmivvaiigilaaiaipqyqnyvarsegasalasvnplkttveealsrgwsvksg
tgtedatkkevplgvaadanklgtialkpdpadgtaditltftmggagpknkgkiitltr
taadglwkctsdqdeqfipkgcsr