PDB entry 1oqs

View 1oqs on RCSB PDB site
Description: Crystal Structure of RV4/RV7 Complex
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-03-11, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 RV-7
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31100 (0-121)
      • conflict (10)
    Domains in SCOPe 2.08: d1oqsa_
  • Chain 'B':
    Compound: Phospholipase A2 RV-4
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqsb_
  • Chain 'C':
    Compound: Phospholipase A2 RV-7
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31100 (0-121)
      • conflict (10)
    Domains in SCOPe 2.08: d1oqsc_
  • Chain 'D':
    Compound: Phospholipase A2 RV-4
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqsd_
  • Chain 'E':
    Compound: Phospholipase A2 RV-7
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31100 (0-121)
      • conflict (10)
    Domains in SCOPe 2.08: d1oqse_
  • Chain 'F':
    Compound: Phospholipase A2 RV-4
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqsf_
  • Chain 'G':
    Compound: Phospholipase A2 RV-7
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31100 (0-121)
      • conflict (10)
    Domains in SCOPe 2.08: d1oqsg_
  • Chain 'H':
    Compound: Phospholipase A2 RV-4
    Species: Daboia russellii siamensis [TaxId:343250]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oqsh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsA (A:)
    nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
    tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
    qc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsB (B:)
    nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
    laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
    qc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsC (C:)
    nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
    tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
    qc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsD (D:)
    nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
    laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
    qc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsE (E:)
    nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
    tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
    qc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsF (F:)
    nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
    laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
    qc
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsG (G:)
    nlfqfgemilqktgkevvhsyaiygcycgwggqgraqdatdrccfvhdccygtvndcnpk
    tatysysfengdivcgdndlclrtvcecdraaaiclgqnvntydknyeyysishcteese
    qc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqsH (H:)
    nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
    laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
    qc