PDB entry 1oqq

View 1oqq on RCSB PDB site
Description: Crystal structure of C73S/C85S mutant of putidaredoxin, a [2Fe-2S] ferredoxin from Pseudomonas putida, at 1.47A resolution
Class: electron transport
Keywords: electron transfer, ELECTRON TRANSPORT
Deposited on 2003-03-10, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.211
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d1oqqa_
  • Chain 'B':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (0-105)
      • engineered (72)
      • engineered (84)
    Domains in SCOPe 2.07: d1oqqb_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqqA (A:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqqB (B:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlscqiimtpeldgivvdvpdrqw