PDB entry 1oqo

View 1oqo on RCSB PDB site
Description: Complex between G0 version of an Fc bound to a minimized version of Protein A called Mini-Z
Class: immune system
Keywords: Antibody, Glycosylation, Oligosaccharides, IgG, Fc Fragment, Z34C, Protein A, IMMUNE SYSTEM
Deposited on 2003-03-10, released 2003-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin gamma-1 heavy chain constant region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC82527
    Domains in SCOPe 2.05: d1oqoa1, d1oqoa2
  • Chain 'B':
    Compound: immunoglobulin gamma-1 heavy chain constant region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAC82527 (0-End)
    Domains in SCOPe 2.05: d1oqob1, d1oqob2
  • Chain 'C':
    Compound: Minimized version of Protein A (Z34C)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OQO (0-33)
    Domains in SCOPe 2.05: d1oqoc_
  • Chain 'D':
    Compound: Minimized version of Protein A (Z34C)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1OQO (0-33)
    Domains in SCOPe 2.05: d1oqod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqoA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqoA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqoB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqoB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqoC (C:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqoD (D:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc