PDB entry 1oqn

View 1oqn on RCSB PDB site
Description: Crystal structure of the phosphotyrosine binding domain (PTB) of mouse Disabled 1 (Dab1)
Class: signaling protein
Keywords: PTB, Inositol, APP, SIGNALING PROTEIN
Deposited on 2003-03-10, released 2003-08-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disabled homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1oqna_
  • Chain 'B':
    Compound: Disabled homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1oqnb_
  • Chain 'C':
    Compound: Alzheimer's disease amyloid A4 protein homolog
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Alzheimer's disease amyloid A4 protein homolog
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqnA (A:)
    drseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqk
    ifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaikta
    qaaepvildlrdlfqliyelkqreelekkaqkdkqceqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqnA (A:)
    rseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqki
    fltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaiktaq
    aaepvildlrdlfqliyelkqreelekkaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqnB (B:)
    drseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqk
    ifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaikta
    qaaepvildlrdlfqliyelkqreelekkaqkdkqceqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqnB (B:)
    drseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqk
    ifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaikta
    qaaepvildlrdlfqliyelkqreelekkaq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.