PDB entry 1oql

View 1oql on RCSB PDB site
Description: mistletoe lectin i from viscum album complexed with galactose
Deposited on 2003-03-10, released 2003-07-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqlA (A:)
    yerlrlrvthqttgdeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qggdsitaaidvtnlyvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqlA (A:)
    yerlrlrvthqttgdeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qggdsitaaidvtnlyvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqlB (B:)
    ddvtcsaseptvrivgrngmcvdvrdddfrdgnqiqlwpsksnndpnqlwtikrdgtirs
    ngsclttygytagvyvmifdcntavreatlwqiwgngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprevtiygfrdlcmesnggsvwvetcvssqknqrwalygdg
    sirpkqnqdqcltcgrdsvstvinivscsagssgqrwvftnegailnlknglamdvaqan
    pklrriiiypatgkpnqmwlpvp