PDB entry 1oql

View 1oql on RCSB PDB site
Description: Mistletoe Lectin I from Viscum album complexed with galactose
Class: hydrolase/sugar binding protein
Keywords: Type-II ribosome-inactivating protein, ricin-like, beta-trefoil, HYDROLASE-SUGAR BINDING PROTEIN COMPLEX
Deposited on 2003-03-10, released 2003-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mistletoe lectin I
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB CAA03513 (0-End)
    Domains in SCOPe 2.08: d1oqla_
  • Chain 'B':
    Compound: mistletoe lectin I
    Species: Viscum album [TaxId:3972]
    Database cross-references and differences (RAF-indexed):
    • GB CAA03513 (0-262)
    Domains in SCOPe 2.08: d1oqlb1, d1oqlb2
  • Heterogens: NAG, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqlA (A:)
    yerlrlrvthqttgdeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qggdsitaaidvtnlyvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqlA (A:)
    yerlrlrvthqttgdeyfrfitllrdyvssgsfsneipllrqstipvsdaqrfvlveltn
    qggdsitaaidvtnlyvvayqagdqsyflrdaprgaethlftgttrsslpfngsypdler
    yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
    nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlaippgnfvtltnvrdviasl
    aimlfvcg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqlB (B:)
    ddvtcsaseptvrivgrngmcvdvrdddfrdgnqiqlwpsksnndpnqlwtikrdgtirs
    ngsclttygytagvyvmifdcntavreatlwqiwgngtiinprsnlvlaassgikgttlt
    vqtldytlgqgwlagndtaprevtiygfrdlcmesnggsvwvetcvssqknqrwalygdg
    sirpkqnqdqcltcgrdsvstvinivscsagssgqrwvftnegailnlknglamdvaqan
    pklrriiiypatgkpnqmwlpvp