PDB entry 1oqj

View 1oqj on RCSB PDB site
Description: Crystal structure of the SAND domain from glucocorticoid modulatory element binding protein-1 (GMEB1)
Class: DNA binding protein
Keywords: sand domain, alpha-beta fold, KDWK motif, zinc-binding motif, DNA BINDING PROTEIN
Deposited on 2003-03-10, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid Modulatory Element Binding protein-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GMEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqja_
  • Chain 'B':
    Compound: Glucocorticoid Modulatory Element Binding protein-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GMEB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oqjb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqjA (A:)
    gamedmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdw
    krairlggimlrkmmdsgqidfyqhdkvcsntcrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqjA (A:)
    dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
    rlggimlrkmmdsgqidfyqhdkvcsntcr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqjB (B:)
    gamedmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdw
    krairlggimlrkmmdsgqidfyqhdkvcsntcrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqjB (B:)
    dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
    rlggimlrkmmdsgqidfyqhdkvcsntc