PDB entry 1oqj

View 1oqj on RCSB PDB site
Description: crystal structure of the sand domain from glucocorticoid modulatory element binding protein-1 (gmeb1)
Deposited on 2003-03-10, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1oqja_
  • Chain 'B':
    Domains in SCOP 1.67: d1oqjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqjA (A:)
    gamedmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdw
    krairlggimlrkmmdsgqidfyqhdkvcsntcrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqjA (A:)
    dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
    rlggimlrkmmdsgqidfyqhdkvcsntcr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqjB (B:)
    gamedmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdw
    krairlggimlrkmmdsgqidfyqhdkvcsntcrstk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqjB (B:)
    dmeiaypitcgeskaillwkkfvcpginvkcvkfndqlispkhfvhlagkstlkdwkrai
    rlggimlrkmmdsgqidfyqhdkvcsntc