PDB entry 1oqf

View 1oqf on RCSB PDB site
Description: Crystal structure of the 2-methylisocitrate lyase
Deposited on 2003-03-08, released 2004-04-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1oqfa_
  • Chain 'B':
    Domains in SCOP 1.69: d1oqfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqfA (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqfA (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqfB (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqfB (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa